ࡱ> }M  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklnopqrstuvwxyz{|~RdO)c(PicturesPowerPoint Document(m$SummaryInformation(H !1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?(((((((.Ye3̿|68",#5@xo$ψ_%wd"[kT)7o_)步 +ʾϬ׶?k| MxIM^i>C1;l'=/.>|Tw쭰@KRW,ɓdZt{DFt/4m~+>q)pv Xex)&4ӫ v6rT_鮶KDtQEzgąQ@Q@Q@QFƟy]WNJFIFHHPhotoshop 3.08BIMHH8BIM x8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM8BIM 8BIM@@8BIM8BIMu} Untitled-1}8BIM8BIM8BIM pXPsJFIFHHAdobed            Xp"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?DI%)$IJ@ͮ1lm[P pi/a1׳1eO'Ӿe7_V؁ n3=oL?n߽m?}nqm) HSI/5?;vd3&noE`n՗:p+F!Cn\e֒2-~V?ɵ۷?FF8 @#I]50s>ʍ9CwߢVW7dfgzFDz5p{CBp;\q=]$EI$JEw*%m FK-XY&̻N-vESs#USgS^5xl!Ѻ(neM<4Y]?_NKۉ&}+ =}|׼LqMs?Jl773:Zl-3e1Mz[ٹ 0M4sk\ufϲQSl&CIJ1kvEM=?Ծ?]kl#f6V2s1qZZ0 (F7:͟9x0#R>|)1~1ó )l rN=?Ph¥5Ѽ@X{ՇQ[>Ƶ; p}/MՈLj܅^wՎ.Dz_\jl}QYes2!dYgDogY D{}-欿3YVcZMTirEa,Z}K?GF 5ߪk qC+q1cVǼ才NFI$DI%)q}1}t˷V qv٨+]UYE]k~n}d176cÇ#ܒqn jcv1W3gX '..}wbc S[v;_ӿWZ}/\_X5N˅@д8s]UYoS?ٿJt9@6lM41bNe.eN}a2=oN1ݙjt6  (¿xɲ%mu7"쬊2~'LHC$;?Uے\?sN+uf-o=_&XkYE_l]պZޝwNq} =oԔ+ͪY油WO%\UNgؚ~m+ZETkc@.p .ZliVdVWm+Q6?ү&.3ZRƱ;|; )ٓюTMNi8]+U_0y5|}':Kݍ\fut;isM!ݱީF8]W=H ڑu! Y`׵_ͭ.ǹco_e_[ bes\{4iwo\Oi?DTu?{m26X wlUߥK0՚=f׈ri_W6vW %;_77vcٲpngQyLX+WW 5bu^)lkQc{e`w;]̫պuYm} 챿35yesZAB  )Q!RvzmEx8Y_ggC}^ۏc뼟7Y]u{6=}-~Oޥr=~AonV}O+g@蹃!ͻ 7羺Kcd3OUi-jQқk `SnuWѶԮ-ʫWRMtS]7mu41aZwCf5mq{{5gSʪ:Sq}b7>Zrg m=[%4YO2;UgV?8,%i;_2_{.elml` kG Q%#*@(W[+ i]c=ϹqmX847ssݓkIucU>\vk}Gv<\m nﴺ׹}֮oAnEwVV1Vlsp\2sT%(˃?/ stL~Twu3EQt+ƫ > ;ub)F-IRI$D$LcYYO#ԥ,ov~jfuK1fEiu}=F?gs ?ϩ$鮛{&Y4wȆ w3W$ꔗ$,Yf-\[lpq C;_|J~}X[CYcv`km"=6z߫Eu|citՉ$-g4 84Xtӿ0[t4k SQJVф 1: R/IU#OZ;b._n0V-uKlDJ@+qoSƍIyzCHQ#fďrnVyaD=/jP5=J]]U4OM׵A)9W-b^i=IJ8]qwy櫽#ko{jҼʓM(dxcc1ig]FkA ܤI$Id%3"s'='No0E%O蛍x4 x.$"Nh8m$>,imNv[죂K[K%FkX.PWFvAMzt=R[fh+IcqhF+K=(/KywkZ>k2pX1Kc-̯)NI(blZF 9xf͊6lثf͊6lثf͊6lثf͊6lثf͊6lثf͊6lثٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lUKW#$U \hԏclUzTmǘu|GoE/Fyv,R*K+(dGWt[YαnY5{TWQ4 3YWI [h^OlR,m8[q`d;?<}Z9dor&KM1hj6_y$m)ѭ $M2J|sb&զe7-cid 8m2STT\yV_M2= -V/55-Y/foKyr_ݿǝ{6*WDOfxQt{k1oW͛ (gF!4x"GY?Uv(o'6*OJMm,t۟1fTHSCG웴mO}Ed{1⌦Dʰ»K͊6lثf͊6lثf͊6lثf͊6lثf͊6lثf͊6lثf͊6lثٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lUO%Dd"ԐAOj7|OPؗ?1Qka"K\֬(i!3|\g:յB{YRx@6 uz*HZU/E-[}hJ˟>^zvj$s/8o,dWv=z}|/L$F* ]G?6LqibAv9Kg6ٷg6%Zk+یаxڀч:&gZjN] 3W\'.5a_jr6<([A4[% J'|мz="z8]W s7Uj\k5d)ZқM5كI(P1 !ݹfŨMh: zߑn=?G8!N>~8&'zOϓsd?I/ld#32~צ?kWŽ mI=6 7p#n66Ö_6l-N͛6*ٳb͛6*ٳb͛6*ٳb͛6*ٳb͛6*ٳbٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6nUUԥ0X{˄Yx`f_#i嶚ZL>FѨ&WoxrBQֿAZ4Z0Gr=5dprL].v`Z[d# |D$IifvG5grY'bEIֹ)w6XtGG-}9QyXՇ Q|[Β+mNTR'Wt+Z/f>aCqJ^C123a/&uKlyG0L?C_lv'Vλmegd,iJD@u$1B1 RO9:VRz*B2>3V42nHbyO3$Γj`M>'n6>O,2":mn/%Xmby]*)cL;+@I)n]cxR;=[Mw<>KY$)-e#P9R~%WYVZpg- (zMصwE(BjTP LqF#֫6#ǾWZ*ʥCi.S"qKoH`/Ӈ/mE0fLh`Q=ū"xoԩb_d Ϟ-.bD ?[~hYX5LǔƷW:El=~>_zc u+j]9 WLԦ OLK礟DW]5inm^)um;W (*4H|V(ї|I'?El?IK_FS!t~i'W|1O<5ޫaasݤ 4Dv*/b?ڏ^@[0~I})49ltxef&)&H.^==3NOU{7i~k/xW>}2ynT\<6zwWB&|r\F|_=:\yчKlx+_Y$P5WP0eiQ>O,y?,OVך;5(58m59Xe*">|ޔl+,_떺Gmf#[Y[C‘fCj5^6 t?^jZ_0ǤFZVӣ)K4V?pfyx{y5c>&7z|YyKNbựm&Ifg puż]M+ XC/_Ĥ] #̮lu+;;[k&pڏVo "-rs p^M7%^Û9C#Z-A ddn4/8X.1jm=.>SQdy|~,?x3f͊6lثff 91UJE$1ƥ;g/^ɦ,Ry1Wxq^EGok=7O,4_"NXۼ ?_N5a4hrVIg迷UѵFUO!ٔvoY1M:C1r'cҼ > ECrQQhܨιش=v][F%6RI^e8&u{n)*YCJ|8q1k͆£uw@b1]4ܤ)Pr,sg?1M9WL-sI1r~OK]B ݔff$QfrX&f.|ÔzG~dkzme)N%"JQx;qoMr)?څ<>ڕΝ%^Ʋzs~Ğ:cbFw/90Fh]jVƋ}{N| I\2:u.{}j<%M- mhSBT8< q͛6*ٳb͛6*ٳbٳf]6lU'46: > Uyj]N1\Ѹ'4~|XsZmq&fQoQ'[?-ۘnҞF'/w yMY毤Z%ơesi H@D!r&dCPEΣs`^O4uӊԑhQ/ /'?Vu+K+^_kkV(Y+-sɚ!mmH_n$k&k%p ܢ#(yo[ң?OIk$>]̄pan'2z52|]2h,<2M:Y伒x"[,~~$_Jo[f/5)|YysQ-gsD]*eHo-q;^ɧj܅ Wsn+Z?k#|<d:=?Ͱ5^yUdZ-۠x >\OQʪ3z{JBƫgif)_$ /E>1D-w˶~cӴ -;2 Bʱ0,[S\wqR;[Zɬ#I2[xm=N(XcYFf {R)nVKrn%xWVQ6%snP4̪-+ؤU75Ž"^`찞 bqS$N{mNc9W4-GD_x`Xpo3uڌȇ"oHoy/4$ZѭK;1ZՏ/Qzd,NwO-YD P7% 91apY.n/g|m X/8VP}O]6d""ϓ6k`ꮽ>G/360yE%u:kmm2UtҵOGꜛQYZccibenn~qf҈f4ǝ6*[}?~bKJ[YjPG-OaBX崚$VzRK,ql|׼{;`/Z/m+43,RnQ}&gn͊~Z(|C Eel)IU*1fY#7LٱWf͛vlٱWf͛vlٱWٳf]6lU:c0VW "VFC{ȩ} d^wz_T~PpUɼ7ċ! ㊼ְCխE_8 *i O?S _Ykx}5S?󗨯kK ,+{$UYi2IdwhJ2GU&2ɽ9LU2VMWT+=!#ԳhෑKtMYbt|i@hk%?R#ѡA`D;M4w 쟢~Ԡc/էWǩ}Z\VC?1xbΣ̼kx[{=6=:=?MV y#Ix$TIn$\$x;v!cn! W-QG~/b2yw¶6oHMoEypT"6!1µ+JA;*1U\ٳb{+}F[; QǼIt,De+1 |;P5MN?ash9Pbv 1=zm[Vdcgm#G T4~>YN~<;9s݁sp13"4ؽ}F:w XzzpƔT VM-1.#5awXeӳf͗7f͛vlٱWf͛vlٱWf͛vlٱWf͛vlٱWf͛Y4[L#@YT!w.5zV*P\3 |A<9P*Fe` 8SqO.]˦SM_Oc䌤*&Og&lrMWλ:iT}OcE* m\Yk)x.`GjH@!َqLtz ]8t' z7t@df8;-=:wU[INY9f^91h,pFRGf͛,u͛6*ٳb͛6*ٳb͛6*ٳbٳf]6lUٳf]6lUٳf]6lUٳfXםK]Bܪ9es331w%Y_!'ӱUh}E1EL?.)y7CՓކY")fcT I k^D4=u\Bhb?\w=؄h>pcd''{Nx5Njq \\}3 __vDw1I KfI' X:3%iQ6ec=uQ!b""gӳf͖8.͛6*yZOVYP8n_D2[Fz~Yz7eh5%ՕC;ֿ̍]GrTYF黋vk*uo8ưON};@mÏ9 WUZʐ”$EMY:^agH˯V(,+PKVa/?4>w/dXn㹎;,RR:K?2/(䍽HߧDcƖ+ GũŹƍQM#KȠV+P%eD2AI$Klkux"ne'Xi6K`9E$I[?gɶ>~OǩExumwe+Gd3Bh~Yy,>7uY~[gu`ip\. s1~hc\.VFZ?9e}R}B=agtX<#SLf|( 98ۏ}sg7/& l{oz=ѡ##Q'7ix)}^G,44]]պ(Iu=Vob\XU^t.T9{YBzǒ4Ӵ Y =k, YӦfO&')o pF"(gDP3d9r!9vlٰ6lyWCiֵ] bټ|9JSJ7͜>t/2ZPѵmD0,Q׉Uݼ޳t+ _J9%/RoMĬ|Yy˜nl.4II2̰e+'dZ_5.~acצC^3U}>tu״&}PO\+e֙msRһ-b䍸dn.e㊼7j6^l^I7kԫ6g=I%nh2I}_ҾBis_Ȓ4D4sG"̦FWs6CVn9<{Nz-%ߩ+%ͽ?G[&7^i͕б֬-ۏiI/H_Xv#XOӮ*-oRii]}f-k82IܣUd?>|o uȤ4nq|&Ǯtɼ&gPt ^1O-s7WgR-;Z֛dy!^v$??|o-w:[+ٮwuf7K1/7y-] vZU( {UsNk:Ƒ 5[!{ 7F`T#aasvVq-ksŏ xȟ^>4|*5\yZtozd6mAy?d~?UOGeG7Q< W`x4\r>d6InOOcCcjO//yOI2 w}rn8r\̩LxtkG[tq?O5OP E=W .ky.?*4I.[-KSt>x욆!ޯC/ t#c u-(TGү?y憝caOGN=9v+Kkro[2V3od(R2_ƣO\ݑxU)'/EZrdS,)l5Vky\|JP28|ʻ kmlc[+'Rn1$m//P۷W:燑58\q)IJU_6uN̊~9kVhxr a洹@Kiq@>m<8'ݼ͊K?8?1nk|+eKk֛s\LM妝5ė-r9:Ֆ_g˭z4fKI! "5$a,l켤Nc:&ݸ nԗKvX/?SUy26Zy[J+h9yo"I$Br?O2鿝._pm;r$~HYm|ȏ5)""a2| /Ot{K'ׯ*'.eOQdo]%%wdO6*?+4 kI6H[-Wl)>27%i^Wu^k.\Kwqƹ諘{y~#'#8 /?Wُr?Ŀޡ Yu+]0&9ȡɅsy@A"oMIxqg6lyf͛vlٱWf͛vlٱWf͛ٳf]6lUٳf]6lUٳf]6lU<)Xnj3 ]޷=S+C( 9숁Ի1䑡 '\FGm>؟)-x%d:hh£;Yk0}G\@<͛6dӳf͊6lثɿ7o8<2Q/,&ci㣛w'b_9yrP40Lmye05z-"^S :!7>nY^6$bhBد4Hy/#f-NRw#,=0[EX'O7׿14 c.*&I.>kJJؿ0 冷kPx.-35'F=Np9dִ1̭3N(ak[?N5X20$mj0:]ֱF5$9kezC*k)O|'~w/Q9zryxϓ{GOXoԑ^aJĥy/?aOevo/?1ln[ 4%ԽRuz_{{P f}_?gz&4iL^[g{d{cp$æU`ڴF;F+ 2l% 4k|gMkߗ_d"wz&iՙ#V0XH\C%^?ia[I+H2jHmԴKy1aЬFZp;}?#MOIӖm*1juA9߹??zXI8=/0g5{+;-R\#EzH?UO=>i$-K S"zJeWE9$,=X8垣|q6A<[x_RiQM/?Jg=$TGrXʹx"͛6*ٳb͛6*^mOO̚Ӭ_?žiC$){#Aghm:l#`>q.l_ԕ=9AVH>9F3SyfJYfh\ٿ$vd%_k# ޒi^F Bo-gK+-DGqU/"ySnkx>}?l} S#Y-I&G/GeX]g7 Ӳ=ܫp6mWKq}or1*+ lU+O/?A}bǟkO=K̃h~0ʾk!U曆uW#l{qCޡŴ"ʒVOĭү4qTfjחP渪[s+^MOqa]_iL=)krC/Hp}NE 3= QտsF?a.]6Gle6G*8aW,ƟlUh:Nlz J:ste"27v|} ւA,D~n3|S<9zFk|6k(dOQbKEg\fbV0^eRx؄T y&ZqĒv$?ڏSV yӅy}\I5Y}W0zKp #)yT,z hu QxJ<8[_k>fnMC5:r~,U,)|ugiz~*dxx&ZݟV6ecigvUQ(5坸~^Yuk(b9$TpxvfŰAtt&]ݱ=Vc3[*͛6*ٳbO4jZdAdgDߵx_Z HĕV ]M F\f` ypbo^2j+$c|_e~W{yh2ޅj=5 .`{[<.;+%)t/[`c5WqogW\Ba1E|Jv؝>d$5EJtl8Hiɥ13 DY]ihC8 ac`w%S"Biu}x:އ8?z"Fbdk'zLJ 4-HU&;ܐ 8%NQ }/Dž~ecՀ;XMn!~yG66Z^k>_֥$Yq%/"$ܟ,S1.uq(G&1[~pdH=~pZZoepOmnkH^0b_[uXGqIҶioagXZ: rvA,Kaknc Fo"qDI +J =u])g{0R$(7CGM=6 "# ,"GĪ\,֑3Ouwy@T/#eXQ_U~ yK6,sGiu"-Ė|y=S} =UYּlŒϦ B[l\vd-IcxpK=1yZ99)3B9WȽ>`)\yb;gu).d7v5Ig?%zmTqW$E%Ќ*X:>*sf͊ٳf]6lUٳf]6lUٳf]6lU"f&$"iRQg5'sSMd꿣=gT[!f&i\;'M鄈ewwk4w4sFyG"+b{~[ Gp^8Gºu5:29#n!! \NjmdZ'̜Yo.}s;3'>;#<ܳ ٳeΕٳfXFs~yYnAıG1țO"Hn*KGʶ_O 7Y, ΣyVy̖Z}*n 8V[[k+{o[qͣ?ŮS~ _-M2in^MIΓ=bI,Y.>n$a -ʌum&b;xt%'`& c42,csk%umtwVW-nu[8x@_mǟka&yWOhn<QkLY7ɡ]o0F]k7m%hG-Ѹh%OVvثʯ.#'U֠MEY}A2ޙ=$-~瘵eм~ְvw+c䚔Vz8V/'`6*a:_-ŁH4M-Fx n_eyd.#][5wZZ}i#k.fT?<ٱWbΡ4wӬX)f L/O`O.&Kӆ&J[՚wq/R9<>oV]h/nܩ CK-g?<3+[-ޗ?)=y *(-zh&H *yf=H_~*I95^{6"ެ][& ;CBnߖ:]]JhYseO&H='>$'O5=@M}[͑d`o|U`0C.5A yдث<ǦgW -λy ͵ĥy!%:iƞHŦfve%,IsEvX7oN/Kin,m&e(WfPj6lثf͊7]lث|.-8+\W>c"?3PQu׳j|r(vnoID]l7K5{4L jISdDy-湆@m$9X}&!:wj<9J$:omt%[&RR* S8?.҆kņ#$Svq4^d-]w4I]M=҃#:'Hhum^cհ5T*?;/՞¶,'>zz;̗fp~ ;u3yU ŮqbhW3io<63~-Q^.GcܜK]=miu[F?QkaE%O@}"8е5.[Y޼"Kq-ɲ!eyfk4VTeR{ډjuwoGÓƟgb(/?˽R_z74yI!gn(s^Fg ?Wf_ٳf]6lUٳf]6lUَlثzZ- $HD ]J|_i p%c"M,Ī@m}6xH Gs{Bk-$9‚Ƭk{⯤j[ԶW n 3Dꂤ(b-1LRH$ʤ[C+㍙榇6m(wǘM;Dx!{YQdZzaHp("򶋧 4^.XTSE.MfE%H&̑"ʂdC> AY>:-ݮàk~b$5a]b(8HV\gHM#ano~Sx-rE/[BYC ,d4Q B?\UkZ5ԞYjfi"Ԯ5g!v%X=iѣ!D >X.u2ZD2(-/A`>=EqBfӾgHNPzJDZ⯠S淓]:!Ӭṓbe]D^ON?e_boQZdA:d <3ſc#kogˬb".nYLѭ,??8׆NCHGM[wՖ>i'|4\ (ЬFITqf^qi[-eUY-DΟb9X||xdTJF,&)IykFfFk%D>ih'1[qZQW?S~fkZmݏ ^; CYK'/XT:F%h?GhVa*oa?Z~}~T#.3Y Me^·uޅUY/T-O#ˇG cfQK^GLeeP}HYcpiˍHh!Ҭnp$XYoH<%Ɨu3\,ba^qF7tZظTXO,e,u{OU&Yb0?Dy#RvlٲZ4ywڤm}?Phxo+^cՏӕ%]eW26-},/4ȴWӞ77t]qsž]|yWE󿛬th[/-ֶ%.. n32Hyq­^gӼǦRM=ug >_(N|c֖͊WiGS.:voSY`I~C|0GUc}uq4/<1,)Ybx.=GO^tث-&f{ش+ח ha"0~<~U`4kIj-obP$I$'tw2wvlٱWV{k>Xf6o$DRԌk-4KmV[k[{2?*KrTثnhe moTM.;FӉ;ǁy#w&mrZi7:#ߟj12QN)G__zqS\i:Q?B5,Q9:Iz> |_mZ1G>j`< -G.l1nwr9eQ~ү9 C_YK;[+PG٥k?Y+(ZGv/jpy~Sn"G,TG9 ׊/_?3'?-m|/XMΖiVYmwdJη+s'U5$7| "H=(V_~9~[_K#n5<hb2VON%UY^XYR7Yߕ--eyȚ$[+iN _gom}2SQj^nQK<7jV#%9?L~l3j͊CЭ&򆥩lh$ HC_2DCsX0/8_yIusjm_U m'8ٱWz%Ƈp52iMoZbzr 6_FN~_W(]yi"> "q4ZzO7O4ko"|yղ&c3^CZX+*}[dByTX˼a7~yOF8/MFrp OUҼ=FFjSL0ctm͊v`/'y{{;,? }AyOu,K[]B-Q!dx/<[-֙,r׍pY³ )_SxZysEQ(|`Y??޺COhcX!usQ[ij'[8GϜW1|6*3^\huΣ=3^YA$"V~?alثf͊6lثf͊#uգ4;DQP5X|2d85~Н;rj0eyevs3LsccӌKc^+ו}*yH(*N̖yFMWW3LiI5q"S_-DGsS.PicGҠ;No,ٳ8 :fPEE$^`7oiul0ʳ\DݿfٱWyy\t/.|&1N^?u[}U$k^dl[N%߭/;ZdKyaY٭_|~^ћyRjjlmCNhd+8.H }fEƲ$Po˺'Kmm Z"4ZCiV4k_9ܳb+5߭ BO`EŞ\\I>.Vj'Eqw_m[IIm R+&4!nysbQ6j m vw<&82{yq$|o>lثf͊DhU\`w"8Za}NF (8g_Vv)jʾyTT6(!1YgO1 Q s'C*[PC^[5OIl.粘RHmSJ8bboza-1y!r VB2ͦ&=U-db?et ̌駧qd7xvlٲM͛6*ٳbJ8˅.G슒w?6*&x$'\@}mB vІ{e gNR(X4Y&ROm2JJЯ_rYЉE*CqQ_4d 3f!ՙث˼s`|jgcVV HeqiPy#pƿ4u[hܪ[ʒJdRKM-~ܾ_Gڥ%Z0_>,q_,]IwXN'ymar8F,sثϯtMS׷O"4,u4[*i\RIxȷLH&8N.yE*4"iQ~oÄzM+KE[w($,5IPM#IGanz ˨Qf]6lUٳf]6lUٳ`-WS,佺`Z.ʥ/">&c)Y&H$5 Y8GȆT$NԚTz^ݱg!UA?d(@3$}:=gƗ ϟw.7T%/$u,>yۼ 'DWN3FqPTuVz~,_ytj7(`xO7XP쿻oM-?UZ) ,ѣ?tf͗7f͛vlٱWf͛vlٱWf͛vlٱWٳf]6lUٳf]6lUٳf]6lUٳf]6lU(>/u4S%9Ol]rպ}~FՖ5\n5 =}f=8kZx}'՗sZowe0~>d4T4ٷ;Ya8aLg`oj3JD@?' 3Vv}ZZc$r%~d#+k5>id(*]]6lٳb͛6*ٳb͛6*ٳbk}6.11hh/\n绹v+VFN6bʂ~zϜ.;Y@@ꀥ=jBO\8A;+@pC>_Џ,oB[X/&9bFy^%Yo3kV^0MܨNE0vQƭq2=_m9,Ǖ|jvb> ? lٖe<92HR6Iqa|ٰvlٱWf͛vlٱWf͛vlٱWf͛vlٱWٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]14o)R)؊ث52]RPyFߒ|/?:/nH5'ȟ":œxdCh|y./B7$;WHXDY ^\[C?.KH΍x8*V*qǐBBF$ЎlEֱ("fٹ7#'zG[Trw?((}Q8{.k&<?ϥE9Ԋ N/}5k ;*Hi֜kL<H7)CƦM.P]V^,d:{6lp~j[ 5ԍ$ՠФx> JcɌpٚ~K,6Eǟ+DZ1Lq?ݍU0Ǽ5~OS/&͑)?14՚=;/I~K67֜/O|$?dz_w2Mܓ6pVꦢ]ddr;dKL"2#&@eؚo3~D6?=]oHe{Ȍ`N ɻ3"4}Ł7h܆]h;Fk ]&_1 (ie?rx>ڜ`Z쌌K_;0߮Q7͔;dO݌ uX7.FsY̗RhO xE9~|ʶK@I <4%R<ރVz=٠Urj(g!B~y676l)JDFKf͊6lUٳf]6lUٳf]6lUٳf]6lUٳf_ٳf]6lUٳf]6lUٳf]6lUٳf]6lUٳf]6lU&Nu{Y& qS9 TeֵXQҶȦ뒱hˇMcR|diȟY\HnIai;K:;H$1 t )Zt-P;Oe}tRȊrcB6LEG.HKe SPV;?wWd:͸%FJO=牡rjEGѕKO#Nng٢2|;E|z)HdrKz NpmOkcvƒ{,gCoylIut*> 7"[*V 4Qe>?$2mVQVV3&il{oR?6}rcHyOdc|?TTpZh͏ ~L%G͌{3ɵ営>,ǽ@{tH,hגM3 C#GɌS=+e]?O7 Y_Ol%vנJ2Yůk ?Hi]!}kKwm΃h:V)aRK1,8u:>!OOibw cз[IM9ix.F/?+)ttc@O6Lqqv,C~^sXӘ"G!CNኮ#jRڌWrW0ؐV=hz}\qǨ ?IGG"JO";;XD @U [/t+ݛ6lPٳb͛6*ٳb͛6*ٳb͛6*ٳb͛6*ٳf]6lUٳf]6lUٳf]3[by b/d)+Dxh>cla6MwWzͧgӽ_,|=p.:+T_U ּ&GL*o3h|ꚕޡ^]4#% '62M[WT}~Ymu/.9lt=BY%)2Q#eJ?#[ƚ^ַME9twd-Σ'J߾t/Zkzeח^U.m%Vdz2IU֥KM+KmASN:Iu./^xn& G7bFMrMȘ=>臄-5}K~F•B)ŭO쾬_P4O B `ӥ󌚕[ʈm#iRvEҞyş Κ5Υi[ri t=OSyZ<֕yi_0ztpn6a/"J^ğ?tX<ծz]_d\ECX3Yڬ_Sot;[g>S綳#I -nm(b,N/ߞsJ{ZRԮӅ=[HdA4soab!ԊQ+~0X~Z:@Py}Fq]f_ުw/xY-m(8tՒ)yI{A5U??82ڡ҆gK+i%qTM;qo5NfO:6lثf͊6lثf͊6lثf͊6lثٳf]6lUٳf]6lUٳf]6lUC?)iiKMU6Eqm*,nU?W>͊Oɺ^q,9V6@%YIT21YnfqQ :UjF[}aG#'!o*N8Uz+kd6*m?Y}a J-~ʫP⿿[[$b͛vlٱWf͛vlٱWf͛vlٱWf͛vlٱWf͛vlٱWf͛vC!oʑ, ĘgwJSӏӗo&9V{v5M KΩ}NU&oZI&'2>m=4勗ԴJ}2G)ԥąӖ癚KoOH,^c{;owdS_d q$BHVK؅ԑ[Y#}y}?@wi|Ӊlx(Y߹9eRYU{2͊6lثf͊6lثf͊6lثf͊6lث٠FB#e49^eJ(JFIF``C C     " }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w@Q@Q@Q@Q@Q@Q@Q@Q@Q@Ve嶝iu}qO=̧jGjYݏ`$nG>|24uj~<>Zw[Ҥ>)-_ 5 ?W^GtWt&B\?πyW_ś#Py% \w_YG9?^z;b0tVC,5}6Qm}\%e8u\/Nki5CmیG8`UfnQqK xiiO_Hb"~׻M}ڊ4>tGmrַq|9dFz}dd[3Bt*JEiEfh(((((((((((((۳֟2$7mXq5ԃhEpz>+Ѽ m{=g-md*՜@H]Gh3I簷f-ʪ~ Ur̤r yy1a>oOKqYdgVXBܫw31{|6"-nc!Gǿ+>2¾oxZ E]7j J?Ĺjk-Jo02I)% t%kO |XH .9x]K,<.mdu8(G :UAf&mc*RvϬdvgoŝo࿊4?]*iBGӁCwz///JomBV"\>`"~P[ vTGۦxd* lɇQk':Ĵ~|x,hFOKH5k=6(l((((((((((((?7ÿxQ3𘴛l#ᛒ{(cڦRQMSV4M$>>)M-~/Qdm_!bCI\r~1k^O O Wte WcP>#KwǏix[t?5, 3FڡC_3jWZs}y3sry1N/?_ܞ ֞wҦ"KߗfH(>(_4^)>wHmȎg!b?u57K2||m7RxxGkH1M'%bNMO.q -{S>g$c̗VxDU=WY<5eYh_->G?RSss]*u|:N2ѾO߅eu 2ʰ{"4_G7)̗Zy$bBZݯQT?sl[Atkɫ4QEhyEPEPEPEPEPEPEPEPEPEP_W:|h^쿅<rQ!r _w~CQx{ *%_ 1nxmWWlG>!nE.wKcr@&BH Mxy-*>);/W%>W:Px^󿊧#}v9?~-u/x|3o_q@x&63y-ӫF ݰ(`F5Q[ow' (;(/0?v$F9md#d}`=k-S1aሧ*u$^Lķ?ƿ Tkx";fͅSyl''Y=3iEwVm} NO)>\+z JQ#j;OEfq`όWvKzׅۯ k]9v*|T=W5GgNz3}gE[KϚ4QE}QEQEQEQEQEQEQEQEQEUY$Y]c5-$@UP9$W¿v= g"E-2|}+.df$B;G+YըɞQUtԷ-ܟWgſ^۫ܰ=w(8>_JǍ7]ͫm4ltHxUDN CBƽ7Ē <%|c7~!!$:å|_'FOU{j^H 6Zji/gEwzK~_QE}hQEYӬ.[=:-4vgM ]RQWz$VxF#pmP$ {g?C/S J:gB+ӍH;I4 (}oKy,s.>x|2?ׄW_*Gw47W NDwdl'vn_-W֬u-kGݥ)%''{"ֹԓrIQs$hr[2rTw|WU}F%y?8&ʒw?愵[lQExEPEPEPEPEPEPEPEPiuokWia趲WAw?E~"[[+76o &ah xcOYGK"6-m^<0AJ_-X|gix>'Ǿ@¸"D/.ѵ˟ k׌PiI\0ۊ70z_F;98?'o,6kq);RGb,/{L9eote3N)O zGon[n*(8(((((((+ξ&xG_o]}:m~H ?,>+k7Kv—$~ν@lV!Q} ژӛ(:XGWߡ~ .G??K5if"0MXկuNZMq%v0@~#m/LJS bU9Yo@ rz'<ȯ ɺ[yĠ̞.QuPܔcF.QEvBQM'8{Z\1֊CݯX0A~:o?x>U"2)# tBP^)xsᵧP+G"2:? |=au:+߷_ h48g%)^lt1?tW~;"%TQ»s+C~xB|Oj z^g=nz<3׸x5}M/o^.f{ Rk;ILu83ەg5uEӔk|:5ݯ8/8sLKOJeמuMvSo+ [r<̢2RW[3 sHE5t (A_KjwíG|=VSshG&r`HК w,7lu19属LDnu"qt(⎫Ϻΰ*Sj+_4|׭CoCҿ~[ZhDZgK2LOoQH$uoj޿ f_go-ޣgmH Bj:q@'yۻKk[kI4t`RHVSЂ ׽bٟGe' W AG9_iGu !?S$~?m> 2ּQ\bH̍E~AxByo|V[^/[y>y]bp۰~w˷9VƯ:׆Wǟ ѮwKT2C~)w}; >1^)߉!oǞҼ!%ɵmʡF L +s]WM%Ē]J Z,NI$I4 ǿR<o1G*H-u`Ch^3¢PGqm(C)ŷG 0i {৅Uc#u)`xh#y*H-{}uM ǃ4~F.lGiʘ!*vU*>!^uOՓg>7./R,=zrqJɨڣ.V<%7&$MVtq٦[sw<6*v< ?|]NURUhp: 㯭wl9 LY.MG4md8WKV4iBj7Io{Mc1?oφO^O'P&J 3,[ ;td<-| W AOxvxoĿ? W:eƣ4R;[@EkhUiQS*Tii%hzI|VU}._%4/ WaO'Z1FrbCw}过>x:t ]Vfc*OPGqm+p,FUMY>{J-]r]yu٦4ղx4i ^QRTܣ +4RK C)ŷx bU@x-0T>=/[?PGqm(QFo :|Ve}[V_#[ `-1=E}SW1x1T#[[F]+Q(>~f3?<]'V+XNsfux@+un+|YN_.x_]FӱTT\ ;cG1 ' .oy-5~hr5s㳞4f8$_D+r/O׷*Q_DxEP_w~߳g=w=/|-9RxKfStDH㑛k??؋^|XA^5Yd*-| }NkR6$עVh2,5:Jp۴Sz u|iP,FHn`YHs2@v'#~:}υ㶗SZfUB#Gj""w*ԓ kk 0|ُcҿ=~eÿ^5(uϊ:6hڋ{{9)>PzqեohI)6yZ:ծVn)|O b:巛?wsӥ_OO&;|/g$Ɠіlfo؏Ns_VU*vJ랦/ t0~G9reksﶷn̟?b ;?xxHѮ[ !/ͨJ"*HԜ淴o㗉R > ]Lk^Gg:koq5,C\ iom E<g7IUA' Iup5BRmdxxǘ_*)X&g(t[O!J1vŬZM.e__ ^4,|8- ߅׭5>4pb9l ??h+j>MKO 5wZ,ܬ"tfQ\w&xjo~er74jW6ZUR,UKB#M8*-||<9'4 4kOx{)HpD|H>c|,#kn"#NR%7kFZOU}[wS9TiŸ{ʤjEd~?OkV-{mԱf|akt' X,~^R-A*LrGXdkg#7 $uDHE01PANrj3n'/ê[M8{馣lugNPkK{=Y(Gk\A{z[ ~"ϑ CWп`O)3{/.ovv=qھ%f.Řf$NI'&M?~: 9KmR^5{*)<0{` CbgRن_ .'mMoo+Is⿄2| ]8(YM 7"c|4({vt&k*,1y1O7e&`B8 s~~<f|>#4mϥ] 0 L?zjNi.kX̥%hC+4UMl۳6e,d-S_kEKcK3wHˍ'b<G,/|e:͞o}dUW"+DHs^r`R&i#f%IuU}}"  %9ZR\7na-ìm3^uLIEJQISOj~`xR--H9x(=_*N[_,OuXɎh# s38>a{Y 2!AOO\ItM(KTYw 쁟8r1T9wezN-YjRn0pj5^EXQEW,W@#H֯Y$F^'GOS=lܩv~w@uZ(JDg#芚?[GX":%|Xd_(3C9P(# (>o dž<G$vW&2/fʜp&q/x+R~iw\h D e' +IgTOUdg,.MX򻹦uKsb[1gn{Oկ촽6KGR;[ 8i%f "K3'/_ ix/ 5ҬK-J/&ynwU_20 6N:WwVp"M˫3xI&ҽݴ^{ψ~+xxjDt5f_Hmn&a6d&'gM1rZk?@6%~U!נq2~ ;2/>sJ4K- E!UhΙQ̾[+uHσ>~_5oxN>&/x^6FY7|#JrqT_5h}-b)1r\`#jQקzO&Og?hԼmkS\Zm6=&0Lz`?O|,oxE_H ' VT-gF8M>i&խzojsūEKup/Hd}_9xP|_WҥEt[k{ⴙ2Wi9f/ٷN_-S~G4[wQEv'`TfDP_h$>~x6kiŻzuyN q:Z)_GxYV\`Wj\wm[J*` (U/Vog-mZ/ ^NN ^ms_ƟWÆӵoǧE/,Ew#.FrXdȿP4ힵZYyj#9m9RF U5}s]߇WPVFhJ"E.\ɳʄQ-s|=ƺ| t 5 HIı*.FWi+ 1pn ?hݾxT`%,TRkKIwKu~QEgƅQ@{%4-j JhiZq3ʟnGgtZ蕢 Ȼ:DKv}]>YG+C,%5kwL%8^>2GDR P@Կ(PO&ol[4neݷqV۾=OuXg ^\fiSjeoru0J`ѩx'tkR?)AaR KЏ_> ?v6ZYi,vk Ƌ訳UA?i ω< uj7ཞi9gX՘H',mρ?Z{VsCZ5]A[@'=+l'OZJ Aו]Z??J{Kݚ:?yWtn?3ſuh'Hf:+ Eu?~/M;=_;=_QYo_o>v9"ԫ/JͽmIVjZg\,NGY:o5%i7d7Vrmn9Tk#;=_;=_V{ת7&V|G|iiNlYVh gpqT~/M;=_;=_WoLɽeFjeѼSe7o/0Gcb9~/M;=_;=_U[Ϻ2{|!߆|CI+ Nn<2J VH G0G ӿ<~(Zhֽ}:~}ݱ$.WXir6ھg?υڴ^8=l58f.-$eZN<_.1i[ 9$N[ꓲik=lkfV0mԥI1w'Mrj> gI&AL^3.a?ڴ+VfmyPg5{~ |?|-e{XizŽZTnq~?x?xh.<ݽk}=.z:Ҏ<}xv-MwavEWƒBGև) ?G) ?U-V#*&~gu催ߝ|;یP@Կ(?AaRC]]\eA4?U# s@5v3AaR K4f7V^-ڍC5 %)(T,H*?g?cOS]|;,oq5aR?:e?0\VĹFUBQVu]ْi%Nlևc+.^w(I4ݭ~%x5/?.S|ie_nH/L[#r$1^vp_v4|ac~CX[ 3ȮNu,\cN"<$i']-<GNNnY%yӷmg.+E~iNӧa|)nqEzR o,F)8]WTQ_._FNx (?+Q]مQ@lxoB>LT FAʙb=+?k3⿊E aܟ\HB<d@|UgJk}z# 7hwwxG/,m.o[v=_?~a>(4>EԟRq{kw |DOy}4Ogga%ʌ- H~׭U KcO/+esrAEW|QEQEQEWǿ 7H6 Rڊ.\ ?ؘآl_kw|]а yڭdp;J0&Yٜ0e[5ӧ?IhnW?1xDxKƗōY JNa z)y} M0xgy81'Z?J{QrK⃳ljFGU]Q|/~6aEWYQ@x#:v緈:k/2 ; *?\|Ꮛ^Kw]96`p@"8h-}~jҏM5Q}%6 ͎11\8њi/N/_C,)^Җްnߕ˱Ӣgt3^5XotRh&P:ᔂ+r4?`ό7?|S3Exi9#2"Y!3_t+*RG}O*O-R/k{uQElx&E(T 2Y:Qi7y~x36Jq5&cpVGj? x*TM!k%P#Vcݷ*t?8 =3zsZIӋo~QsP4Mˑm)iϣ:/? ~%jXC ZA[u$Wd{^y #},?)??AXOŏt_RN*1l -(ҧeVr?GXR5ƒC 1G(?80v<fZE/?L$ϥ'G3ďkӴك6l4T}OѫO#Z u/DP<fo0Eig/ K 7IEf5|[kic@?{xB z|䞕$|oCȕ0kxZj=e, ay^" Ĭ󞂴V}+j<57VOc8F0+F.Wr-vϼ~+Kw 'FOn+H#&Y[$fsMwTQ_Y<ի*)6տ (QEQEQES # /v8/ټV7v$lF3EJw"?M{2G?_G2G?_\_C_*?GXR5?zc%zc%_+ig;HK O&?S⿆;\ n26*GpsW$|oCȔ$|oCȔG%g8w 51؊q&MYc=S|fW=sᯎ)±}P}R+n6=Ѿ88&f>xFxA6ڬ 3))4cE"75sgw/[Aԑӆ"~LJYG{{]nϼh(o q2/ 0DAriales (PCL6Pss&DWingdingsPCL6Pss& DCG TimesPCL6Pss&0DTimes New RomanPss&@DSymbolew RomanPss&PDCG Times (PCL6)Pss& b .  @n?" dd@  @@``   !     M(31/21     !      o$$$R$Ɵy]WN&$R$#e49^eJ(B& 0AAPmb@8xʚ;)Z8ʚ;g4BdBdsi0Pm Xp pP<4dddd``gʚ; <4BdBd``ʚ; <4!d!d``ʚ;0___PPT10 X___PPT9:2h___PPT2001D<4X?  O  Y The Atkins Nutritional Approach is an Effective Tool for Treating Metabolic Syndrome X A GP s perspectives^Dr Sarah BrewerMetabolic Syndrome X ]Metabolic syndrome X is associated with: Insulin resistance High insulin levels Glucose intolerance Overweight, especially around the waist High blood pressure High levels of harmful very low density lipoprotein cholesterol (small dense particles) Low levels of beneficial HDL-cholesterol High triglyceride levels Increased blood clotting factors R)5( !3  ! ^ Metabolic Syndrome X The European Group for the Study of Insulin Resistance defines Metabolic syndrome as: Insulin levels in the highest 25% of the population range PLUS two of the following: fasting glucose levels > 6.1 mmol/l but < 7.0 mmol/l high blood pressure > 140/90 mmHg plasma triglycerides > 2 mmol/l or HDL < 1mmol/l Central obesity: waist measurement greater than 94cm in men or 80cm in women &WZ:ZZZ !     !  "   !M ! b     =  c Metabolic Syndrome X |All these clinical factors are important, independent risk factors for heart disease and stroke, and often lead to Type 2 diabetes if left untreated Recent evidence suggests these traits together interact to produce more damage to artery walls than expected from their additive effects alone As many as one in five people are believed to have metabolic syndrome in the UK Metabolic syndrome has been described as a  cardiovascular time-bomb jZ``` ` F``@ Metabolic Syndrome X  There is excellent evidence that improving single risk factors such as high blood pressure, raised glucose levels or abnormal cholesterol levels can reduce the risk of heart attack and stroke Research is now investigating whether aggressive diet and lifestyle changes at an early stage in the development of metabolic syndrome might prevent the development of these major risk factors altogether All the clinical signs associated with metabolic syndrome X can be reduced or even reversed by following a low-carb diet ^  ! y  !  Results of a High-Carb Diet :The underlying cause of metabolic syndrome is insulin resistance in which body cells lose their sensitivity to insulin hormone; this may be linked with obesity Foods that raise blood sugar levels stimulate the production of insulin to help push excess glucose into adipose cells for storage as body fat Cells become increasingly insensitive to the effects of insulin when levels are persistently raised, so more and more insulin is produced to help maintain normal blood sugar levels People with metabolic syndrome are basically over-dosing on glucose and insulin `;1 !  ! P !; !<Result of Carbohydrate Intake$ The Obesity Epidemic in the UK Insulin is a storage hormone that actively promotes overweight and obesity More than half the adult population of England (two thirds of men and half of women) are overweight and 20% of these are obese . 1,000 people in England reach the stage of obesity every day In 2001, 8.5% of 6 year olds and 15% of 15 year olds were classed as obese due to a combination of over eating and lack of physical activity. __>_____K"#    >    b``,  Benefits of Weight Loss (Losing 10kg in weight (22lb) has been shown to: blood pressure by 10/20 mmHg fasting blood glucose levels by 50% triglycerides by 30% total cholesterol levels by 10% harmful LDL-cholesterol by 15%  good HDL-cholesterol by at least 8% For someone who is obese, losing 10kg can reduce their overall risk of premature death by 20% and their risk of diabetes-related death by as much as 30% 00  %  " ! ' ! ,  -Evaluation of the Atkins Nutritional Approach..- 28 people with Type 2 diabetes who could not achieve good glucose control 9 were previously treated with diet alone, 19 were on oral hypoglycaemic drugs (although these were discontinued at the start of the trial). All followed a low-carb diet supplying 25% of daily energy in the form of carbohydrate for 8 weeks After 8 weeks, they switched to a diet providing the same amount of energy, but with 55% carbohydrate Gutierrez M et al.. Journal of the American College of Nutrition 1998. 17(6): 595-600 W)   !  ! b !e !#V#  $ W 0 Evaluation of the Atkins Nutritional Approach 1/$ .  After the first 8 weeks (low-carb) there were significant improvements in blood glucose control and haemoglobin A1c levels When they switched back to the so-called  healthy 55% carbohydrate diet, their glucose control worsened again and their haemoglobin A1c level rose significantly over the following 12 weeks Conclusion: a low-carb, low calorie diet had beneficial effects in people with Type 2 diabetes, and may reduce their need to move on to insulin treatment r ( ! (6  ! c $5$$! -Evaluation of the Atkins Nutritional Approach..- A controlled trial funded by the American Heart Association randomised 53 obese females to 6 months of an ad libitum very low carbohydrate diet or a calorie restricted, low fat (30%) diet Both groups reduced calorie consumption by comparable amounts at 3 and 6 months Total intake of saturated fat was not excessive At 3 months the low-carb group consumed 20.7% saturated fat 20.6% monounsaturated fat and 9% polyunsaturated fat At 6 months the low-carb group consumed 17.4% saturated fat 15.8% monounsaturated fat and 8.2% polyunsaturated fat The percentage of saturated fat is consistent with other studies following free-living individuals using the Atkins Nutritional Approach <0Z-Zj 9*m  9 -Evaluation of the Atkins Nutritional Approach.-- Mean levels of blood pressure, lipids, fasting glucose and insulin improved in both groups Even through the low carb dieters ate more calories per day by 6 months, compared with those on the low fat diet (1302 Vs 1247) they lost significantly more weight and body fat The low-carb group lost more weight (8.5kg vs 3.9kg) and more body fat (4.8kg vs 2kg) than the low fat group with no adverse effect on cardiovascular risk factors  A very low carbohydrate diet is more effective than a low fat diet for weight loss and, over 6 months, is not associated with deleterious effects on cardiovascular risk factors in women *oZ\ ad\  !    A Calorie is Not a Calorie? This trial, and others, suggest that a low carbohydrate diet provides a metabolic advantage  For the greater weight loss in the low carbohydrate diet to result from decreased calorie consumption alone, the group would have had to consume 300 fewer calories per day over the first 3 months compared with the low fat diet group  Although the inaccuracy of dietary records for obese subjects is well documented, it seems unlikely that a systematic discrepancy of this magnitude occurred between groups of subjects who were comparably overweight. Quotes: Brehm et al, J Clin Endocrinol Metab 2003, 88(4):1617-1623 J\R\Q7           -Evaluation of the Atkins Nutritional Approach..- The researchers concluded that:  For the greater weight loss in the low carbohydrate diet to result from decreased calorie consumption alone, the group would have had to consume 300 fewer calories per day over the first 3 months compared with the low fat diet group Consider calorie reduction Consider metabolic advantage0!'%"#"H 1 Evaluation of the Atkins Nutritional Approach &2 /One year, controlled trial involving 63 obese men and women Average BMI 34kg/M2 Randomised to either a low-carb (high protein, high fat) diet, or a conventional low calorie, low fat diet Those on the low-carb diet had a statistically significant greater weight loss for the first 6 months (7% body weight versus 3.2% body weight), and maintained greater weight loss at 12 months (even though carb intake had been increased greatly) although not statistically significant Foster GD et al, New Eng J Med 2001; 348;21:2082-2090. > " 2Pm`&5"&% @2 Evaluation of the Atkins Nutritional Approach $3. There was little difference in the LDL-cholesterol between the two groups Both diets significantly decreased diastolic blood pressure and the insulin response to a known intake of glucose Those on the low-carb diet had greater improvements in serum triglycerides and HDL-cholesterol than those on the conventional diet These beneficial changes were as good as can be obtained with some medications RK`rd33a` @ $K r -Evaluation of the Atkins Nutritional Approach..-  The researchers concluded:  The low-carbohydrate diet was associated with a greater improvement in some risk factors for coronary heart disease  & the changes are greater than those expected from a moderate weight loss alone ^`s``d33Rd33 -Evaluation of the Atkins Nutritional Approach..132 severely obese subjects randomly assigned to a low-carb diet or a calorie and fat restricted diet 6/12 Mean BMI 43 kg/M2 39% had diabetes, 43% metabolic syndrome Of the 79 subjects that completed the study (low fat dieters were twice as likely to drop out), those following a low-carb diet lost more weight than those on the low fat diet (5.8kg vs 1.9kg) irrespective of their use or non-use of drugs to lower blood glucose or cholesterol levels r|@H.@```bB/ Evaluation of the Atkins Nutritional Approach00/ rNine out of 64 people starting the low carbohydrate diet eventually lost at least 10% of their body weight compared with only 2 out of the 68 people who started on the low fat diet Triglyceride levels by over 20% for those on the low-carbohydrate diet versus only a 4% for those on the low fat diet Insulin sensitivity was measured in the people with diabetes and was found to have improved more in those following the low-carb diet ZbEbbBf33 B  ,/  -Evaluation of the Atkins Nutritional Approach..- ^The researchers concluded that: & . being assigned to the low-carbohydrate diet was an independent predictor for improvements in triglyceride levels and insulin sensitivity d!$$33$33$33! -Evaluation of the Atkins Nutritional Approach..- These studies provide important information for doctors caring for people who are obese, especially if they also have metabolic syndrome X or diabetes Type 2 Focussing on low-fat diets has not worked, frequently resulting in increased caloric consumption and weight gain Low fat diets providing < 30% fat have been shown to result in conversion from large fluffy LDL particles to the atherogenic sub type made up small dense particles in those individuals genetically predisposed Well controlled, peer reviewed research has demonstrated that following a controlled carbohydrate approach results in significantly decreased triglyceride levels, increased HDL, and decreased LDL levels in many people, as well as a reduction in postprandial triglyceride levels v &33#di2   l Metabolic Syndrome X }A low carb diet can reverse factors associate with Metabolic syndrome X: Insulin resistance High insulin levels Glucose intolerance Overweight, especially around the waist High blood pressure High levels of harmful very low density lipoprotein cholesterol (small dense particles) Low levels of beneficial HDL-cholesterol High triglyceride levels Increased blood clotting factors RI5H !3  ! ~ Low-Fat Diets Have Failed Anticipated outcomes have not been achieved Obesity, metabolic syndrome, diabetes and heart disease are all increasing Alternative solutions need to be explored Controlling carbohydrates ( ANA) has been scientifically validated and is worthy of further research    0Science Supports the Atkins Nutritional Approach11k More than 400 published, peer-reviewed studies support the concepts underlying the Atkins Nutritional Approach In the last three years, 19 studies focusing on the ANA have all supported the safety and efficacy of the controlled carbohydrate approach Information on all these studies and supporting scientific information is available for review at www.atkins.comPk ($\/p  ` 33` Sf3f` 33g` f` www3PP` ZXdbmo` \ғ3y`Ӣ` 3f3ff` 3f3FKf` hk]wwwfܹ` ff>>\`Y{ff` R>&- {p_/̴>?" dd@ ?dd@o " @ ` n?" dd@   @@``PV    @ ` `Zp>>  T(    0D> 0 \  @*x2   s *S"?@ x   s *S"?  0@C> `  RClick to edit Master text styles Second level Third level Fourth level Fifth level!     S  6A> ```@  T Click to edit Master title style! !d   C .AAtkinslogo"p7  Z޽h ?"` 33D<___PPT10..ZipA TitlePageU    (    0A> ^ `  @*x2  s *S"? x  s *S"?  0`>>  ` 0  [#Click to edit Master subtitle style$$   6C> ^   T Click to edit Master title style! !d   C .AAtkinslogo"@L*  Z޽h ?"` 33D<___PPT10..^i` `*(    0 F P   X*   0F    Z* d  c $ ?     0 F  @  RClick to edit Master text styles Second level Third level Fourth level Fifth level!     S  6 F PPo   X*   6 F P o  Z* H  0޽h#6 ? ̙3380___PPT10.0~` p8(    0 P   >*   0    @*   6 PPo   >*   6 P o  @* H  0޽h#6 ? ̙3380___PPT10.dyē~ @%(    HE ^     BE  ` 0    0`E K  2  H  0޽h ? 33___PPT10i.Zi1H+D=' = @B +  t$(  tr t S ```@   r t S `  H t 0޽h ? 33  |$(  |r | S 0```@   r | S `  H | 0޽h ? 33  x$(  xr x S ```@   r x S p`  H x 0޽h ? 33  $(  r  S P```@   r  S `  H  0޽h ? 33  $(  r  S 9>```@   r  S =>`  H  0޽h ? 33l  { (  ~  s *`A>P     bAbloodsugarrcp\   00 K  2  H  0޽h ? 33___PPT10i._i +D=' = @B +  `(  ~  s *P``@     < `    0 K  2  V  Bp TN Sources: National Audit Office  Tackling Obesity in England, February 2001MMM   B0`4 ;TOAST (The Obesity Awareness & Solutions Trust), March 2000<<< H  0޽h ? 33___PPT10i._i +D=' = @B +  $(  r  S ```@   r  S `  H  0޽h ? 33  $(  r  S 0```@   r  S `  H  0޽h ? 33   $(  r  S P```@   r  S `  H  0޽h ? 33  0H$(  Hr H S p`@   r H S ``  H H 0޽h ? 33  @$(  r  S ```@   r  S `  H  0޽h ? 33y  P0(  x  c $4p   x  c $`4`P  H  0޽h ? 33y___PPT10Y+D=' = @B +  `$(  r  S 4```@   r  S 3`  H  0޽h ? 33  SKp(  x  c $2P   x  c $ 5`    05 K  2  H  0޽h ? 33d   (  r  S 9`    s @90e0e #" 0ePPP0   H  0޽h ? 33  $(  r  S ;```@   r  S ;`  H  0޽h ? 33z  *"(  x  c $`:    x  c $@<`    6< 0 i3Samaha FF et al N Engl J Med 2003; 348:21, 2074-81.44  0`= K  2  H  0޽h ? 33   $(   r   S `PP@   r   S p`  H   0޽h ? 33  $(  r  S p```@   r  S `  H  0޽h ? 33  $(  r  S p   r  S з`  H  0޽h ? 33  00(  x  c $E```@   x  c $E`  H  0޽h ? 33  ,$(  ,r , S к```@   r , S p`  H , 0޽h ? 33  SK(  x  c $    x  c $0`    0P K  2  H  0޽h ? 33 (  ^  S       c $ @   8Insulin plays an important role in normal metabolism. Digestible carbohydrates are broken down into blood sugar (glucose). Insulin delivers glucose to the body cells to use as energy. Increased glucose elevates insulin output. Elevated insulin causes blood glucose to drop, leading to food cravings and overeating. Excessive carbohydrate intake leads to storage of body fat. Insulin switches off lipolysis and switches on fat storage While the body is storing fat it does not burn fat  otherwise energy is wasted in futile cycling 8- H  0޽h#6 ? ̙3380___PPT10.\paX  P,(  ^  S       c $P @   " H  0޽h#6 ? ̙33 {s (  X  C     s  S  8 @T  <4___PPT9 7Foster GD et al, New Eng J Med 2001; 348;21:2082-2090. X7 " 25"&7 H  0޽h#6 ? ̙33 (  ^  S     y  c $`7 @T  <4___PPT9 7Foster GD et al, New Eng J Med 2001; 348;21:2082-2090. X7 " 25"&7 H  0޽h#6 ? ̙33cxp^RЀ3ÿ lHbP  @AL G@;b `B&VAADS q/%$UcZCAN_mN%+n}bN@A@AYv`/%$%AexQEABAJVZK%,]cPKA@?DQjjk)%&%C_sU@B@ABAAHRr5%%$%$%&b` [GB?BA @BA@Td o\$%$%$/qmPABBA@A@DYb8%&$+)%&Og TDBAA@AB@B??A?N]XT'%)dG%1`uTOA@ABRLA@DR{zp0%5~[*%NZVB@A?FZOCBA@MTpB%dCj:#%(lgbHA@BAA@@SNYGAWoxd&%$%$9j{oe%9owRA@AGXsS@@B@AF^`B#%&_Uݠm9%&\kSIARXߩXI@ABOj[^(&% <[`b'$$%9`_SAGQeQ@@BAA@BGQām8&%&Ra\;%&XZWE@?A ?M^OF?A @BAQ[ŁǼ qoV(' &/lhT*&'1qwƌjPFE HWgPFEG\ڸǁarnordba`~wkopee`a`rlonopniowWPQgqtl|UQlwutr ssttowqqsrxwȁ9H& *1K+''&&'(1*'(&'4'&'&(0%&'&CJ_kXW Y]pYWWXXWW\ZXWW]XWXX_XWXgfŁ7/<zthcQ3w>y7i"hs]vv?3L_`DNnCxglgZOjD_g٧˽ʫǡØ7/a H8 1Or"f+ӓ CA7 63L_`DIqjJbVy[DCaܬIsniIfD_gƍ⑟଼͍ˎգŁ7/C)7ۼ8d!ykB=;3L_`DQraFkDENiDDDZŎsj̭kCD_gèٝ⌍ܢ͍ݷ̦Ɂ7/Osn7Ò#e!W!;$o3L_`DEz̐EkCENΩ\EDYX˴lTZHD_g˾߸ߏۛ΋ХҎɁ7/ r@]V%8O7Ov NVv0ll3L_`DMpSN[FjwgVyKz~cED_gړ嚍բ՘簾؁93 \Fbs2N& -O,F0?F"7; D+BM96M%^aEFFEFFrK̐cvZI`v^Rs_lqUeiLKq`pviOFEFF_f/ԥܺ΁7UCDCaEBC DBADVMCCDCDEDBCDWKBCCEDWMCCAKF^sgfgvgffggfqlfgefgrkgfggfpngfgkcˁ  gr:9Bin_]:;;:;;Lstʻyc\^]^]]\^^c|̽bf^]\kֿi?%$?ao\,%bpZH@A@A@ITsQCA@A@@BRpf[+%$bqeB%7efQA@?RrWJA?FSb?%3qxc%)X[SH@A@EZyR@@A@APXdn765j`qB65Er}dWEGEFFDXg]KGEFFKW~Ya\\]\[\Yee\]\lGRRQRQPQQOPoPQOOTUzght~~|}~}mnpq|EEECCCCŁɁĆЁCՁׁC܁ށCCCC         ṴCCK      l      l      UCC܁ށCԁׁĆЁCŁȁCCCr̸Ձҁ   W̭EEHHHӁׁHƁHKKށKǁˁKMM܁߁MāOOOɁ́3333333333Ɂ33333333333333333333333333333333333333333 3333333333333 3333333333 33 333333 3333333333 333333 33333333 T܁ށTWWŁɁYYˁ΁[[ʁ́] ] Áǁ`!c"c"сӁe# g$!j%"j%Ձ"ׁm&݁#o'$r(%x*'z+(|,).+1.74 ՜.+,0H    $ On-screen ShowCAtkins Nutritionals, Inc.y  Arial Wingdings CG TimesTimes New RomanSymbolCG Times (PCL6) TitlePageu The Atkins Nutritional Approach is an Effective Tool for Treating Metabolic Syndrome X A GP’s perspectiveMetabolic Syndrome XMetabolic Syndrome XMetabolic Syndrome XMetabolic Syndrome XResults of a High-Carb Diet!Result of Carbohydrate IntakeThe Obesity Epidemic in the UKBenefits of Weight Loss.Evaluation of the Atkins Nutritional Approach1 Evaluation of the Atkins Nutritional Approach .Evaluation of the Atkins Nutritional Approach.Evaluation of the Atkins Nutritional ApproachA Calorie is Not a Calorie?.Evaluation of the Atkins Nutritional Approach2 Evaluation of the Atkins Nutritional Approach 3 Evaluation of the Atkins Nutritional Approach .Evaluation of the Atkins Nutritional Approach.Evaluation of the Atkins Nutritional Approach0 Evaluation of the Atkins Nutritional Approach.Evaluation of the Atkins Nutritional Approach.Evaluation of the Atkins Nutritional ApproachMetabolic Syndrome XLow-Fat Diets Have Failed1Science Supports the Atkins Nutritional Approach  Fonts UsedDesign Template Slide Titles#_ Simon Jones